PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29706.m001283
Common NameLOC8284653, RCOM_0652480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 340aa    MW: 38379.3 Da    PI: 9.0923
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29706.m001283genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.23.8e-2577120144
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                    d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  29706.m001283  77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 120
                    79***************************************987 PP

2QLQ61.62.1e-211146136
            QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                   s+FT++Q+q+L++Q+l+yKy++++ P+PpeL++ ++
  29706.m001283 11 SPFTPSQWQELEHQALIYKYMVSGIPIPPELIFTVK 46
                   89*****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.9E-131147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.9E-161245IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.7321247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.06477121IPR014977WRC domain
PfamPF088793.1E-2178120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MLNATSTRNR SPFTPSQWQE LEHQALIYKY MVSGIPIPPE LIFTVKRSLE SSLASRLFPH  60
QPIGWGCFQV GFGRKADPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GRNRSRKPVE  120
LTSSTTNNTT ASTVTNPSLS INRSLSATTT NNNTTSPSGS SYSFSPLSSP MEPEFHASGH  180
NNILSPFPYS HSSSSRPQNS TTHNLFLDSG STSHVDKDYR YFNGMREGID ERTFFPEASS  240
GSSRNLQDSY QQLTMSSYKS YSHPQFESLA DSTSKHQQEQ PQHCFVLGTD FKSSTTRTIK  300
LEKESEAQKP LHHFFGEWPP KNSDSWLDLA STSRLHTADS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2569872e-53KC256987.1 Caragana korshinskii GRL2 (GRL2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521329.10.0PREDICTED: growth-regulating factor 5
SwissprotQ8L8A62e-78GRF5_ARATH; Growth-regulating factor 5
TrEMBLB9S5R00.0B9S5R0_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s16920.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-68growth-regulating factor 5